PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000574942
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 956aa    MW: 101376 Da    PI: 8.3244
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000574942genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.6e-18506553148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++lv++ +++G g+W++ ++  g++R++k+c++rw +yl
    MDP0000574942 506 KGPWTPEEDQKLVEYLERYGHGSWRALPKLAGLNRCGKSCRLRWTNYL 553
                      79********************************************97 PP

2Myb_DNA-binding51.91.7e-16559604148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++ +lG++ W++Ia+ ++ gRt++++k++w+++l
    MDP0000574942 559 RGNFSQEEEQTILNLHSLLGNK-WSAIASNLP-GRTDNEIKNFWNTHL 604
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046743.4E-90206479IPR006766Phosphate-induced protein 1
PROSITE profilePS5129418.57501553IPR017930Myb domain
SuperFamilySSF466898.8E-31504600IPR009057Homeodomain-like
SMARTSM007179.0E-16505555IPR001005SANT/Myb domain
PfamPF002494.3E-17506553IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-24507560IPR009057Homeodomain-like
CDDcd001678.82E-12508553No hitNo description
PROSITE profilePS5129426.109554608IPR017930Myb domain
SMARTSM007171.2E-16558606IPR001005SANT/Myb domain
PfamPF002492.7E-15559604IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-26561608IPR009057Homeodomain-like
CDDcd001671.56E-11561604No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 956 aa     Download sequence    Send to blast
MGNRLGNRQL AALALCLVLL LDVTTTTLVL ASKKGKGGGG GHGKGGGGGH GKGGGSNKGA  60
AKKHGGPQKG GAHGTAGAKP GGAKPTPTPN AVGAAPAAGG TVPAPGTVGA NPNPIPNAGP  120
GAYLTPMPNA GGAYPIPIPD AGGANPIPIP DAGGAAPAAG GTVPAPGTAG AKPGGVNPTP  180
TPTPNAGGAA HATGGTVPAP GVGGPITYHG GPLMTGNINL SILFYGEFKS EQREVIRTFL  240
RSLENTENDH VAAVHRWWDI VESYQLFASP TPGKGTPPKL RIKVGTQQSD DKYSIGKVIT  300
YEFIKRLLKK ADSGKPNTIT VIFTGSQVTV HSLCRGRCYE HGLVENRPYI VVGNPEILCS  360
GSCAWPFQRL DYGTPNQVPV KPPNGDMGID AMVVHFASAL ASAVTNPFNT GFFKPGPKSD  420
PIEAVTACEN IFGSGAVPGQ TGKVEVDPAT GASYNAIGEN GMKFMLPAVW DPRTSSCWTS  480
ISSATASAWC DDDQDEKSST DTMIKKGPWT PEEDQKLVEY LERYGHGSWR ALPKLAGLNR  540
CGKSCRLRWT NYLRPDIKRG NFSQEEEQTI LNLHSLLGNK WSAIASNLPG RTDNEIKNFW  600
NTHLKKKLLK MGIDPVTHNP ISTTGTNIDH HQYLMIINQI LSSLAPQLLA ASSSSSCSST  660
STCNPLMLNN PWEWDRINNI NNNVNMNALL GLHLSDAKTE VLQTILQQQL LSTGSPPNNS  720
NYVEAALNYL LGSSSYSYNN SVPDDHHQQI CGQYHSHHHP QSFSVNIGAP VHTNTQFSHL  780
SIPNIIHKPP HLLEHDQQPL PVYVASSAGP ASNLIYTAGT MINKTGQQLG GPSSGSYSYA  840
TPTVASDHHQ LPLLVPSPEC SAANINLMTG NKIVDTRTNN PNTNQDHVIS DPNSRSTSTT  900
STTFEAWGDL MDHHDEPTNH SYWKHIILDP MFFRYTFLLG IKSMFSRPIS RRQPD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-315066087108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008382129.10.0PREDICTED: uncharacterized protein LOC103444930
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2295744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.21e-66myb domain protein 9